Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPR203W  from Saccharomyces cerevisiae S288C
>YPR203W|YPR203W YPR203W SGDID:S000006407, Chr XVI from 943880-944188, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (102 aa)
MRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPHMFLLLHVDELSIFSAYQASLPGEKKVDT
ERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDVLHVCCPS