Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR200C  from Saccharomyces cerevisiae S288C
>YPR200C|YPR200C ARR2 SGDID:S000006404, Chr XVI from 939671-939279, Genome Release 64-1-1, reverse complement, Verified ORF, "Arsenate reductase required for arsenate resistance; converts arsenate to arsenite which can then be exported from cells by Arr3p" ORGANISM: Saccharomyces cerevisiae S288C (130 aa)
MVSFITSRQLKGLIENQRKDFQVVDLRREDFARDHITNAWHVPVTAQITEKQLNQLIKGL
SDTFSSSQFVKVIFHCTGSKNRGPKVAAKFETYLQEEDITSKFESCILVGGFYAWETHCR
ESNLKLIVSG