Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR188C  from Saccharomyces cerevisiae S288C
>YPR188C|YPR188C MLC2 SGDID:S000006392, Chr XVI from 912479-911988, Genome Release 64-1-1, reverse complement, Verified ORF, "Regulatory light chain for the type II myosin, Myo1p; binds to an IQ motif of Myo1p, localization to the bud neck depends on Myo1p; involved in the disassembly of the Myo1p ring" ORGANISM: Saccharomyces cerevisiae S288C (163 aa)
MDHSESLTFNQLTQDYINKLKDAFQMLDEDEDGLISRGDLTKIYATLGKTLTDEEWSKMV
PDNDTSTAEVGEEGVSFPIFLSIMGKNLSQFPEREELEESLKAIGRGHDLNVPLNEVIDS
LKEAGFENPEEEFAKLFKLFTTNQQATEERTFRGKLFLDSITD