Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR187W  from Saccharomyces cerevisiae S288C
>YPR187W|YPR187W RPO26 SGDID:S000006391, Chr XVI from 911257-911276,911353-911800, Genome Release 64-1-1, Verified ORF, "RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III; part of central core; similar to bacterial omega subunit" ORGANISM: Saccharomyces cerevisiae S288C (155 aa)
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQ
HEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRI
AMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL