Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR182W  from Saccharomyces cerevisiae S288C
>YPR182W|YPR182W SMX3 SGDID:S000006386, Chr XVI from 900194-900454, Genome Release 64-1-1, Verified ORF, "Core Sm protein Sm F; part of heteroheptameric complex (with Smb1p, Smd1p, Smd2p, Smd3p, Sme1p, and Smx2p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm F" ORGANISM: Saccharomyces cerevisiae S288C (86 aa)
MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFV
AGVSHGTLGEIFIRCNNVLYIRELPN