Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPR170W-B  from Saccharomyces cerevisiae S288C
>YPR170W-B|YPR170W-B YPR170W-B SGDID:S000028515, Chr XVI from 883239-883387,883487-883595, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function, conserved in fungi; partially overlaps the dubious genes YPR169W-A, YPR170W-A and YRP170C" ORGANISM: Saccharomyces cerevisiae S288C (85 aa)
MRPVVSTGKAWCCTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPAVAHTVYLAAL
VYLVFFVFCGFQVYLARRKPSIELR