Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR168W  from Saccharomyces cerevisiae S288C
>YPR168W|YPR168W NUT2 SGDID:S000006372, Chr XVI from 878076-878549, Genome Release 64-1-1, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; required for transcriptional activation and has a role in basal transcription" ORGANISM: Saccharomyces cerevisiae S288C (157 aa)
MNGNSTNNEQLQQELATTQDQVASIIESFVELGVSIYDFPGTPEATKGMITNLQRNVDRL
YKLNVRSNDPQSSLSKVDIPLEVVQYIEDGRNPDIYTREFVEAIRRSNQYQRGKMHGLKQ
LRDSLADKIVDEFPELKEPVEDIIKRTSPIDNVSNTH