Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR165W  from Saccharomyces cerevisiae S288C
>YPR165W|YPR165W RHO1 SGDID:S000006369, Chr XVI from 875368-875997, Genome Release 64-1-1, Verified ORF, "GTP-binding protein of the rho subfamily of Ras-like proteins, involved in establishment of cell polarity; regulates protein kinase C (Pkc1p) and the cell wall synthesizing enzyme 1,3-beta-glucan synthase (Fks1p and Gsc2p)" ORGANISM: Saccharomyces cerevisiae S288C (209 aa)
MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVEL
ALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILV
GCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAAT
RASLMGKSKTNGKAKKNTTEKKKKKCVLL