Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPR159C-A  from Saccharomyces cerevisiae S288C
>YPR159C-A|YPR159C-A YPR159C-A SGDID:S000028725, Chr XVI from 860415-860314, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (33 aa)
MATLDFTTKPLALVIYMSVVLLLMVGVPLLFSS