Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPR145C-A  from Saccharomyces cerevisiae S288C
>YPR145C-A|YPR145C-A YPR145C-A SGDID:S000113589, Chr XVI from 824926-824690, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (78 aa)
MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIR
NLQSQGKRRSDSKESRKL