Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR133W-A  from Saccharomyces cerevisiae S288C
>YPR133W-A|YPR133W-A TOM5 SGDID:S000006433, Chr XVI from 797557-797709, Genome Release 64-1-1, Verified ORF, "Component of the TOM (translocase of outer membrane) complex responsible for recognition and initial import of all mitochondrially directed proteins; involved in transfer of precursors from the Tom70p and Tom20p receptors to the Tom40p pore" ORGANISM: Saccharomyces cerevisiae S288C (50 aa)
MFGLPQQEVSEEEKRAHQEQTEKTLKQAAYVAAFLWVSPMIWHLVKKQWK