Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR132W  from Saccharomyces cerevisiae S288C
>YPR132W|YPR132W RPS23B SGDID:S000006336, Chr XVI from 794965-795029,795395-795767, Genome Release 64-1-1, Verified ORF, "Ribosomal protein 28 (rp28) of the small (40S) ribosomal subunit, required for translational accuracy; nearly identical to Rps23Ap and similar to E. coli S12 and rat S23 ribosomal proteins; deletion of both RPS23A and RPS23B is lethal" ORGANISM: Saccharomyces cerevisiae S288C (145 aa)
MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIE
SKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGV
RFKVVKVSGVSLLALWKEKKEKPRS