Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR131C  from Saccharomyces cerevisiae S288C
>YPR131C|YPR131C NAT3 SGDID:S000006335, Chr XVI from 794498-793911, Genome Release 64-1-1, reverse complement, Verified ORF, "Catalytic subunit of the NatB N-terminal acetyltransferase, which catalyzes acetylation of the amino-terminal methionine residues of all proteins beginning with Met-Asp or Met-Glu and of some proteins beginning with Met-Asn or Met-Met" ORGANISM: Saccharomyces cerevisiae S288C (195 aa)
MTTIQPFEPVDLFKTNNVNLDILTENFPLEFYFEYMIIWPDLFFKSSEMTVDPTFKHNIS
GYMMAKTEGKTTEWHTHITAVTVAPRFRRISLASKLCNTLETMTDVMPHEVNFIDLFVKC
NNQLAIKLYEKLGYSVYRRVVGYYNSAEDGYPDTLKKVDDNKDAFDMRKAMARDRNRSVR
PDGRSHKCYPHDVRF