Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR102C  from Saccharomyces cerevisiae S288C
>YPR102C|YPR102C RPL11A SGDID:S000006306, Chr XVI from 731748-731224, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of the large 60S ribosomal subunit, nearly identical to Rpl11Bp but expressed at twice the level; involved in ribosomal assembly; depletion causes degradation of 60S proteins and RNA; similar to E. coli L5 and rat L11" ORGANISM: Saccharomyces cerevisiae S288C (174 aa)
MSAKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
RNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSI
GIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLDK