Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR101W  from Saccharomyces cerevisiae S288C
>YPR101W|YPR101W SNT309 SGDID:S000006305, Chr XVI from 730492-731019, Genome Release 64-1-1, Verified ORF, "Member of the NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs; interacts physically and genetically with Prp19p" ORGANISM: Saccharomyces cerevisiae S288C (175 aa)
MDGLSFVDKGKIPDGYKNEIDQLVKKEFANIKREPVHPEIRGILAKRKGADNSVSTLTNA
LYTEYLKQRNNKKRRTPDFNDDDDTLFLEEYRRKYPRIDTSRYIPNESSEVSLLGIVDSY
LKHQEIVLDTLLPQTVSNQWRINNDYIRQTCTIVEEMNIQQRKQINDLEIYRKRL