Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPR098C  from Saccharomyces cerevisiae S288C
>YPR098C|YPR098C YPR098C SGDID:S000006302, Chr XVI from 729385-728947,729528-729482, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, localized to the mitochondrial outer membrane" ORGANISM: Saccharomyces cerevisiae S288C (161 aa)
MCLVKTTAHLLFYSFVFGGTTFYSYVASPIAFKVLEKDQFSALQNKIFPYFFQMQAASPV
ILALTAPIALTTGPLSSLVVASVSGLTNLFWLLPWTHKVKEQRKNIAKKYTGSELEAKDA
ILRKEFGKSHGLSLLFNLSNVCGMLAYGVCLSGGLLRKIPK