Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR082C  from Saccharomyces cerevisiae S288C
>YPR082C|YPR082C DIB1 SGDID:S000006286, Chr XVI from 704656-704225, Genome Release 64-1-1, reverse complement, Verified ORF, "17-kDa component of the U4/U6aU5 tri-snRNP, plays an essential role in pre-mRNA splicing, orthologue of hDIM1, the human U5-specific 15-kDa protein" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIY
LCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETI
FRGARKNKGLVVSPYDYNHKRVS