Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR062W  from Saccharomyces cerevisiae S288C
>YPR062W|YPR062W FCY1 SGDID:S000006266, Chr XVI from 677165-677641, Genome Release 64-1-1, Verified ORF, "Cytosine deaminase, zinc metalloenzyme that catalyzes the hydrolytic deamination of cytosine to uracil; of biomedical interest because it also catalyzes the deamination of 5-fluorocytosine (5FC) to form anticancer drug 5-fluorouracil (5FU)" ORGANISM: Saccharomyces cerevisiae S288C (158 aa)
MVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSAT
LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEK
YLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIGE