Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR052C  from Saccharomyces cerevisiae S288C
>YPR052C|YPR052C NHP6A SGDID:S000006256, Chr XVI from 665974-665693, Genome Release 64-1-1, reverse complement, Verified ORF, "High-mobility group (HMG) protein that binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Bp; homologous to mammalian HMGB1 and HMGB2" ORGANISM: Saccharomyces cerevisiae S288C (93 aa)
MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWK
ALTPEEKQPYEAKAQADKKRYESEKELYNATLA