Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR043W  from Saccharomyces cerevisiae S288C
>YPR043W|YPR043W RPL43A SGDID:S000006247, Chr XVI from 654166-654167,654571-654847, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl43Bp and has similarity to rat L37a ribosomal protein; null mutation confers a dominant lethal phenotype" ORGANISM: Saccharomyces cerevisiae S288C (92 aa)
MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCC
KKTVAGGAYTVSTAAAATVRSTIRRLREMVEA