Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPR036W-A  from Saccharomyces cerevisiae S288C
>YPR036W-A|YPR036W-A YPR036W-A SGDID:S000028425, Chr XVI from 645950-646153, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; transcription is regulated by Pdr1p" ORGANISM: Saccharomyces cerevisiae S288C (67 aa)
MVAFLELTSDVSQPFVIPSLSPVSQPSSRKNSDANVDDLNLAIANAALLDASASSRSHSR
KNSLSLL