Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR028W  from Saccharomyces cerevisiae S288C
>YPR028W|YPR028W YOP1 SGDID:S000006232, Chr XVI from 623527-623577,623711-624202, Genome Release 64-1-1, Verified ORF, "Membrane protein that interacts with Yip1p to mediate membrane traffic; interacts with Sey1p to maintain ER morphology; overexpression leads to cell death and accumulation of internal cell membranes" ORGANISM: Saccharomyces cerevisiae S288C (180 aa)
MSEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGE
ILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFL
KTVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH