Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR020W  from Saccharomyces cerevisiae S288C
>YPR020W|YPR020W ATP20 SGDID:S000006224, Chr XVI from 599870-600217, Genome Release 64-1-1, Verified ORF, "Subunit g of the mitochondrial F1F0 ATP synthase; reversibly phosphorylated on two residues; unphosphorylated form is required for dimerization of the ATP synthase complex" ORGANISM: Saccharomyces cerevisiae S288C (115 aa)
MLSRIQNYTSGLVSKANLLSSKALYYGKVGAEISKQIYLKEGLQPPTVAQFKSVYSNLYK
QSLNFALKPTEVLSCLKNIQKNELLKYGAYGIQLIGFYSVGEIIGRRKLVGYKHH