Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPR017C  from Saccharomyces cerevisiae S288C
>YPR017C|YPR017C DSS4 SGDID:S000006221, Chr XVI from 593917-593486, Genome Release 64-1-1, reverse complement, Verified ORF, "Guanine nucleotide dissociation stimulator for Sec4p, functions in the post-Golgi secretory pathway; binds zinc, found both on membranes and in the cytosol" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MSKATCSFEGCHSAVITINDDNIINLPEQVHSEFKLLENRTMRDATPSESNFLVVPDVWD
FDNVGVSREIPSSILGDLSDKSDFVFEYGNSSWKIKKCLKYLICADCDKGPIGIICKVQD
QTKNEERVLHLLSLRSLQIMGRN