Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPR010C-A  from Saccharomyces cerevisiae S288C
>YPR010C-A|YPR010C-A YPR010C-A SGDID:S000122558, Chr XVI from 582558-582373,582734-582702, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; conserved among Saccharomyces sensu stricto species" ORGANISM: Saccharomyces cerevisiae S288C (72 aa)
MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDETLRLTGNPEL
SSLDEVLAKDKD