Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL282C  from Saccharomyces cerevisiae S288C
>YPL282C|YPL282C PAU22 SGDID:S000006203, Chr XVI from 8427-7933, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, member of the seripauperin multigene family encoded mainly in subtelomeric regions; identical to Pau21p; encodes 2 proteins that are translated from 2 different start codons" ORGANISM: Saccharomyces cerevisiae S288C (164 aa)
MTNEGIGINRDTSTICLREYVFIHFFPVKLISALTNKTNTMVKLTSIAAGVAAIAAGVAA
APATTTLSPSDERVNLVELGVYVSDIRAHLAQYYLFQAAHPTETYPVEIAEAVFNYGDFT
TMLTGIPAEQVTRVITGVPWYSTRLRPAISSALSKDGIYTAIPK