Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPL278C  from Saccharomyces cerevisiae S288C
>YPL278C|YPL278C YPL278C SGDID:S000006199, Chr XVI from 15355-15053, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; gene expression regulated by copper levels" ORGANISM: Saccharomyces cerevisiae S288C (100 aa)
MTDNTTSSDLIKNVETARSTIDGLIESLGWIELNYRCERQCNWDEVCYTPSWGPSPMGMT
EPGSHNEGFGTHFDESRQRLVINSKLQCININDLMVNRNH