Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL271W  from Saccharomyces cerevisiae S288C
>YPL271W|YPL271W ATP15 SGDID:S000006192, Chr XVI from 30079-30267, Genome Release 64-1-1, Verified ORF, "Epsilon subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; phosphorylated" ORGANISM: Saccharomyces cerevisiae S288C (62 aa)
MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI
TK