Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL249C-A  from Saccharomyces cerevisiae S288C
>YPL249C-A|YPL249C-A RPL36B SGDID:S000006438, Chr XVI from 75985-75699,76239-76224, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Ap and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA" ORGANISM: Saccharomyces cerevisiae S288C (100 aa)
MAVKTGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDL
IRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH