Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL239W  from Saccharomyces cerevisiae S288C
>YPL239W|YPL239W YAR1 SGDID:S000006160, Chr XVI from 99484-100086, Genome Release 64-1-1, Verified ORF, "Cytoplasmic ankyrin-repeat containing protein of unknown function, proposed to link the processes of 40S ribosomal subunit biogenesis and adaptation to osmotic and oxidative stress; expression repressed by heat shock" ORGANISM: Saccharomyces cerevisiae S288C (200 aa)
MGLHSEPLDQEDQDTIILDARAGDLDSLKDIFTTLVSPELLSTCKESESDSTALHMAAAN
GHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADP
FIRNKFGHDAIFEAENSGKEEVETYFLKKYDVEPEDDEEDTQTEGKNSVQITKGTEIEQV
TKEATEALREETEKLNINKD