Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL220W  from Saccharomyces cerevisiae S288C
>YPL220W|YPL220W RPL1A SGDID:S000006141, Chr XVI from 135790-136443, Genome Release 64-1-1, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl1Bp and has similarity to E. coli L1 and rat L10a ribosomal proteins; rpl1a rpl1b double null mutation is lethal" ORGANISM: Saccharomyces cerevisiae S288C (217 aa)
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPR
PNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQV
PRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLV
NQILMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY