Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL200W  from Saccharomyces cerevisiae S288C
>YPL200W|YPL200W CSM4 SGDID:S000006121, Chr XVI from 171484-171954, Genome Release 64-1-1, Verified ORF, "Protein required for accurate chromosome segregation during meiosis; involved in meiotic telomere clustering (bouquet formation) and telomere-led rapid prophase movements" ORGANISM: Saccharomyces cerevisiae S288C (156 aa)
MMDGSITRKVTSTLSNQLATWKWKLQLSLLERKLATINNDYFLLQWELLFITNEVMKWKE
MIAFLESQLFCTTQNFVAQETHDRETFQSLVDDYNKQLSENNLIISVLKSRPQLSSFPIY
LSDEVCSHLKFVIAELNSLIIVFFISLVFLWVSIEV