Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL192C  from Saccharomyces cerevisiae S288C
>YPL192C|YPL192C PRM3 SGDID:S000006113, Chr XVI from 183056-182655, Genome Release 64-1-1, reverse complement, Verified ORF, "Pheromone-regulated protein required for nuclear envelope fusion during karyogamy; localizes to the outer face of the nuclear membrane; interacts with Kar5p at the spindle pole body" ORGANISM: Saccharomyces cerevisiae S288C (133 aa)
MTAMKEDNAALITLKKNNDQEKLRVHKLTDASSNSADGFVINKAKNGGPLNKKSLVNNEQ
HIKKAVSPGRVRKHKTTTSSTKSRTKSKKKDASESKVQRENKGSFYQGAIFGSFLGAAVT
TVLSNLAVKALQN