Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL189C-A  from Saccharomyces cerevisiae S288C
>YPL189C-A|YPL189C-A COA2 SGDID:S000028527, Chr XVI from 188513-188307, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytochrome oxidase assembly factor; null mutation results in respiratory deficiency with specific loss of cytochrome oxidase activity; functions downstream of assembly factors Mss51p and Coa1p and interacts with assembly factor Shy1p" ORGANISM: Saccharomyces cerevisiae S288C (68 aa)
MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDSPAVQQHKLQLAHEQELKR
KDALSKKI