Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL170W  from Saccharomyces cerevisiae S288C
>YPL170W|YPL170W DAP1 SGDID:S000006091, Chr XVI from 228314-228772, Genome Release 64-1-1, Verified ORF, "Heme-binding protein involved in regulation of cytochrome P450 protein Erg11p; damage response protein, related to mammalian membrane progesterone receptors; mutations lead to defects in telomeres, mitochondria, and sterol synthesis" ORGANISM: Saccharomyces cerevisiae S288C (152 aa)
MSFIKNLLFGGVKTSEDPTGLTGNGASNTNDSNKGSEPVVAGNFFPRTLSKFNGHDDEKI
FIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIKDWDQPIDPLDDLT
KEQIDALDEWQEHFENKYPCIGTLIPEPGVNV