Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL166W  from Saccharomyces cerevisiae S288C
>YPL166W|YPL166W ATG29 SGDID:S000006087, Chr XVI from 237338-237979, Genome Release 64-1-1, Verified ORF, "Autophagy-specific protein that is required for recruitment of other ATG proteins to the pre-autophagosomal structure (PAS); interacts with Atg17p and localizas to the PAS in a manner interdependent with Atg17p and Cis1p; not conserved" ORGANISM: Saccharomyces cerevisiae S288C (213 aa)
MIMNSTNTVVYIKVKGRRPQGFLDPPKFEWNGTKERQLWTMVSNLNYSQDQIDWQNLSKI
FETPEFFLKKRTYKLFAEHLELLQLQLEKKRDLEKYSNDQVNEGMSDLIHKYTPTLQNDN
LLNVSASPLTTERQDSEEVETEVTNEALQHLQTSKILNIHKKTSDSENKPNDKLDKDGIN
KEMECGSSDDDLSSSLSVSKSALEEALMDRLQF