Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPL152W-A  from Saccharomyces cerevisiae S288C
>YPL152W-A|YPL152W-A YPL152W-A SGDID:S000028721, Chr XVI from 264602-264700, Genome Release 64-1-1, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (32 aa)
MMVHLTLKSHLIKEELLWHALSPSYSCRYHGR