Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL143W  from Saccharomyces cerevisiae S288C
>YPL143W|YPL143W RPL33A SGDID:S000006064, Chr XVI from 282122-282140,282666-282970, Genome Release 64-1-1, Verified ORF, "N-terminally acetylated ribosomal protein L37 of the large (60S) ribosomal subunit, nearly identical to Rpl33Bp and has similarity to rat L35a; rpl33a null mutant exhibits slow growth while rpl33a rpl33b double null mutant is inviable" ORGANISM: Saccharomyces cerevisiae S288C (107 aa)
MAESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAYVYRASKEVR
GSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI