Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL130W  from Saccharomyces cerevisiae S288C
>YPL130W|YPL130W SPO19 SGDID:S000006051, Chr XVI from 304387-305058, Genome Release 64-1-1, Verified ORF, "Meiosis-specific prospore protein; required to produce bending force necessary for proper assembly of the prospore membrane during sporulation; identified as a weak high-copy suppressor of the spo1-1 ts mutation" ORGANISM: Saccharomyces cerevisiae S288C (223 aa)
MKKQILIVAAQSILCSTVFGERSNVGLSTEELGGDSILYFNEDPIVIEIDKKAIDKKTLE
QLASTRDVVLTDLPDTLEFIDFNEYAKMKSKSDMLLEYINEYEFDDFERSSEGGLEEEEE
EDLIYDFNAQAEDLGKLGSNIYEVVEEKNIVNTYDGNLINASTTESTTTIRPFVTSHSYV
ASSTPYSNISSLNEDYDNASNFLTPTTVALAVLLTILLFIQAY