Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YPL119C-A  from Saccharomyces cerevisiae S288C
>YPL119C-A|YPL119C-A YPL119C-A SGDID:S000028859, Chr XVI from 324287-324024, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (87 aa)
MHPLVDELTLSRYLTHGTSVLSSSLYSVAFFLFFFPNFLFFCSCPNHKWVSLPFIGMDIL
EALCFYREGKIRNIFEIGGLLLQSFYN