Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL108W  from Saccharomyces cerevisiae S288C
>YPL108W|YPL108W YPL108W SGDID:S000006029, Chr XVI from 348446-348952, Genome Release 64-1-1, Uncharacterized ORF, "Cytoplasmic protein of unknown function; non-essential gene that is induced in a GDH1 deleted strain with altered redox metabolism; GFP-fusion protein is induced in response to the DNA-damaging agent MMS" ORGANISM: Saccharomyces cerevisiae S288C (168 aa)
MKEASDREEAPKMVEKNYSTGFRKAHGEKDQSVTKPISLDGRTGEVIVRKSTGKTKIRKG
QTEEEYTQQLQHYFEVEQGPVRTKVGWMDEVDPLVEIREGKYDISNKHQRQVLSGFCHRL
FYQCKYKECLDLSTYFLGLFEPFNVKNKMKRELEELEYMIERCRGHVL