>YPL096C-A|YPL096C-A ERI1 SGDID:S000028423, Chr XVI from 366735-366529, Genome Release 64-1-1, reverse complement, Verified ORF, "Endoplasmic reticulum membrane protein that binds to and inhibits GTP-bound Ras2p at the ER; component of the GPI-GnT complex which catalyzes the first step in GPI-anchor biosynthesis; probable homolog of mammalian PIG-Y protein" ORGANISM: Saccharomyces cerevisiae S288C (68 aa)
MRPRDQGFLVLGFTYSVLLISLATFYWLRNNDSFLHYWCVLLLCPATLWLWALIAWCDSE
MFASSKDE