Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL059W  from Saccharomyces cerevisiae S288C
>YPL059W|YPL059W GRX5 SGDID:S000005980, Chr XVI from 444579-445031, Genome Release 64-1-1, Verified ORF, "Hydroperoxide and superoxide-radical responsive glutathione-dependent oxidoreductase; mitochondrial matrix protein involved in the synthesis/assembly of iron-sulfur centers; monothiol glutaredoxin subfamily member along with Grx3p and Grx4p" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRKAIEDAIESAPVVLFMKGTPEFPKC
GFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVI
TSMARSGELADLLEEAQALVPEEEEETKDR