Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL056C  from Saccharomyces cerevisiae S288C
>YPL056C|YPL056C LCL1 SGDID:S000005977, Chr XVI from 453735-453430, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; deletion mutant is fluconazole resistant and has long chronological lifespan" ORGANISM: Saccharomyces cerevisiae S288C (101 aa)
MKNAALCEALPLLATCSHEIPPTPHTVCFVFPPALLLSPSKLTLLNSRRVASRCVIIIDP
RLLRLFSCSRPQQLPRDKNQSFAKPSFSFFFFLLTSLLSPF