Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL047W  from Saccharomyces cerevisiae S288C
>YPL047W|YPL047W SGF11 SGDID:S000005968, Chr XVI from 465962-466261, Genome Release 64-1-1, Verified ORF, "Integral subunit of SAGA histone acetyltransferase complex, regulates transcription of a subset of SAGA-regulated genes, required for the Ubp8p association with SAGA and for H2B deubiquitylation" ORGANISM: Saccharomyces cerevisiae S288C (99 aa)
MTEETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGSLDING
LQKQQESSQYIHCENCGRDVSANRLAAHLQRCLSRGARR