Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL046C  from Saccharomyces cerevisiae S288C
>YPL046C|YPL046C ELC1 SGDID:S000005967, Chr XVI from 466943-466644, Genome Release 64-1-1, reverse complement, Verified ORF, "Elongin C, conserved among eukaryotes; forms a complex with Cul3p that polyubiquitylates monoubiquitylated RNA polymerase II to trigger its proteolysis; plays a role in global genomic repair" ORGANISM: Saccharomyces cerevisiae S288C (99 aa)
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFDSHILEKAVEY
LNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI