Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YPL037C  from Saccharomyces cerevisiae S288C
>YPL037C|YPL037C EGD1 SGDID:S000005958, Chr XVI from 481901-481428, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit beta1 of the nascent polypeptide-associated complex (NAC) involved in protein targeting, associated with cytoplasmic ribosomes; enhances DNA binding of the Gal4p activator; homolog of human BTF3b" ORGANISM: Saccharomyces cerevisiae S288C (157 aa)
MPIDQEKLAKLQKLSANNKVGGTRRKLNKKAGSSAGANKDDTKLQSQLAKLHAVTIDNVA
EANFFKDDGKVMHFNKVGVQVAAQHNTSVFYGLPQEKNLQDLFPGIISQLGPEAIQALSQ
LAAQMEKHEAKAPADAEKKDEAIPELVEGQTFDADVE