Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR394W  from Saccharomyces cerevisiae S288C
>YOR394W|YOR394W PAU21 SGDID:S000005921, Chr XV from 1082718-1083212, Genome Release 64-1-1, Verified ORF, "Protein of unknown function, member of the seripauperin multigene family encoded mainly in subtelomeric regions; identical to Pau22p; encodes 2 proteins that are translated from 2 different start codons" ORGANISM: Saccharomyces cerevisiae S288C (164 aa)
MTNEGIGINRDTSTICLREYVFIHFFPVKLISALTNKTNTMVKLTSIAAGVAAIAAGVAA
APATTTLSPSDERVNLVELGVYVSDIRAHLAQYYLFQAAHPTETYPVEIAEAVFNYGDFT
TMLTGIPAEQVTRVITGVPWYSTRLRPAISSALSKDGIYTAIPK