Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YOR394C-A  from Saccharomyces cerevisiae S288C
>YOR394C-A|YOR394C-A YOR394C-A SGDID:S000028718, Chr XV from 1084369-1084202, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (55 aa)
MIVNNTHILTLPPHAVSTLTCILIWHRHTDATVYIISSYPTLTFHSMAHLSLHQY