Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YOR391C  from Saccharomyces cerevisiae S288C
>YOR391C|YOR391C HSP33 SGDID:S000005918, Chr XV from 1079258-1078545, Genome Release 64-1-1, reverse complement, Verified ORF, "Possible chaperone and cysteine protease with similarity to E. coli Hsp31 and S. cerevisiae Hsp31p, Hsp32p, and Sno4p; member of the DJ-1/ThiJ/PfpI superfamily, which includes human DJ-1 involved in Parkinson's disease" ORGANISM: Saccharomyces cerevisiae S288C (237 aa)
MTPKRALISLTSYHGPFYKDGAKTGVFVVEILRSFDTFEKHGFEVDFVSETGGFGWDEHY
LPKSFIGGEDKMNFETKNSAFNKALARIKTANEVNASDYKVFFASAGHGALFDYPKAKNL
QDIASKIYANGGVIAAICHGPLLFDGLIDIKTTRPLIEGKAITGFPLEGEIALGVDDILR
SRKLTTVERVANKNGAKYLAPIHPWDDYSITDGKLVTGVNANSSYSTTIRAINALYS